PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35862_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 308aa    MW: 34962.9 Da    PI: 8.144
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35862_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-17203249148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ed+ l ++v q+G++ W+ I++++  gR +kqc++rw+++l
   Neem_35862_f_1 203 KGQWTPQEDKTLMRLVSQYGTKKWSQISKMLT-GRVGKQCRERWYNHL 249
                      799****************************9.*************97 PP

2Myb_DNA-binding46.39.5e-15255295143
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      +++WT++Ed +l++a+k+ G++ W+ Iar++  gRt++ +k++
   Neem_35862_f_1 255 KDSWTEDEDIILIQAHKEVGNR-WAEIARRLR-GRTENTIKNH 295
                      679*******************.*********.*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.965198253IPR017930Myb domain
SuperFamilySSF466891.4E-29201295IPR009057Homeodomain-like
SMARTSM007173.1E-15202251IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-27204257IPR009057Homeodomain-like
PfamPF139216.9E-19206264No hitNo description
CDDcd001672.09E-14206249No hitNo description
PROSITE profilePS5129413.239254308IPR017930Myb domain
SMARTSM007172.7E-8254307IPR001005SANT/Myb domain
CDDcd001676.55E-11257295No hitNo description
Gene3DG3DSA:1.10.10.604.4E-18258295IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEFDSSFRDD YPFLASLFSD NLFKSDLENG FSFLENSSSK GLFHNLHTSV DHGPISECFS  60
SPDQFNRFST EGSSKNPSFG ISTPSFDAIE AYTNRVSGSG IGFSSTHLMP NGVNEVLHGS  120
ESGRFWDYSQ NFSAQPASET QIYQPVMNYP QCGSSSTARL PDEVSCITGE NAYHQDQKAD  180
QKRCNRMHVR KGRKLPKRNS IIKGQWTPQE DKTLMRLVSQ YGTKKWSQIS KMLTGRVGKQ  240
CRERWYNHLK PDIKKDSWTE DEDIILIQAH KEVGNRWAEI ARRLRGRTEN TIKNHGSPAD  300
CAAELRIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-40201295296C-Myb DNA-Binding Domain
1mse_C3e-40201295296C-Myb DNA-Binding Domain
1gv2_A3e-40201295296MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180197QKRCNRMHVRKGRKLPKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446542.11e-138hypothetical protein CICLE_v10017526mg
TrEMBLV4U1M71e-138V4U1M7_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.17e-65myb domain protein 118